PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa000164
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family GRF
Protein Properties Length: 411aa    MW: 44136.4 Da    PI: 7.8662
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58690225PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-30958PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.98.8e-24185229145
        WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                d+epgrCrRtDGKkWRC ++++ ++k+CErH++rgr+rsrk++e 
  Lsa000164 185 DPEPGRCRRTDGKKWRCAKDAVVDQKYCERHMNRGRHRSRKPVEG 229
                79****************************************986 PP

2QLQ58.52.1e-20114150137
        QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                ++FT++Q+++L++Q+l+yKy+ an+ +P++Ll +i+k
  Lsa000164 114 GPFTPSQWMELEHQALIYKYITANAAIPSNLLIPIRK 150
                59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.3E-11114150IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088809.0E-15115149IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.81115150IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.811185229IPR014977WRC domain
PfamPF088792.9E-20186228IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MDFGVLDGLV SSDNHNKNTL ISCGDLDLKP KWFGSGGGFG KQESPISALA TGTREDEWRD  60
LKMAKIGEDD ISRRSNGAQN MLSFSSPNTQ TVTFPYYARH NTVSGYGAGA GAGGPFTPSQ  120
WMELEHQALI YKYITANAAI PSNLLIPIRK ALESAAFSAY SGAHLRQNSS VGWGALHLGF  180
CNSSDPEPGR CRRTDGKKWR CAKDAVVDQK YCERHMNRGR HRSRKPVEGQ TCKLTTSTAV  240
LRHTSSQPVT PNPAATSSED NMSVVNKASF EATVVPMSSP TSVDLKKNQF SIGGTEFGFV  300
CSDSLLNPMH KSDLKSQNPL HQFMEDSNQG QLSISVSTNS DGFVSSTTSP TSHSLLRMGL  360
GMGKMTTNAQ HDVSWETSMG GPLGEVLNTS PVGPKLDDGG LGTTIGLGHL L
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074333.11e-101PREDICTED: growth-regulating factor 6-like
TrEMBLA0A103XXM81e-123A0A103XXM8_CYNCS; Glutamine-Leucine-Glutamine, QLQ
STRINGSolyc04g077510.2.15e-98(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-51growth-regulating factor 2